Recombinant Human CHRM1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P11229

Gene Name: CHRM1

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Ile211

End Site: Glu360

Coverage: 0.34

Isoelectric Point: 9.5

Core Sequence: IYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Muscarinic acetylcholine receptor M1

Protein name: cholinergic receptor muscarinic 1

Full length: 460 amino acids

Entry name: ACM1_HUMAN

• SKU: ASBPP-4375-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4375-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 1128