Recombinant Human CHRNA4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P43681

Gene Name: CHRNA4

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: Glu391

End Site: Asp590

Coverage: 0.34

Isoelectric Point: 6.5

Core Sequence: EPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Rat - 61%, Pig - 63%, Cynomolgus monkey - 89%

Alternative gene names: NACRA4

Alternative protein names: Neuronal acetylcholine receptor subunit alpha-4

Protein name: cholinergic receptor nicotinic alpha 4 subunit

Full length: 627 amino acids

Entry name: ACHA4_HUMAN

• SKU: ASBPP-3087-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3087-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1137