Recombinant Human CHRNA9 Protein

Recombinant Human CHRNA9 Protein
SKU
ASBPP-417-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UGM1

Gene Name: CHRNA9

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Asn381

End Site: Lys450

Coverage: 0.18

Isoelectric Point: 10

Core Sequence: NLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQYKVLTRNIEYIAKCLKDHKATNSKGSEWKK

Homologies: Highest protein sequence identity to the following orthologs: Rat - 81%, Pig - 74%, Cynomolgus monkey - 93%

Alternative gene names: NACHRA9

Alternative protein names: Neuronal acetylcholine receptor subunit alpha-9; Nicotinic acetylcholine receptor subunit alpha-9; NACHR alpha-9

Protein name: cholinergic receptor nicotinic alpha 9 subunit

Full length: 479 amino acids

Entry name: ACHA9_HUMAN
More Information
SKU ASBPP-417-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-417-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 55584
Product information (PDF)
×
MSDS (PDF)
×