Recombinant Human CHRNA9 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UGM1

Gene Name: CHRNA9

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Asn381

End Site: Lys450

Coverage: 0.18

Isoelectric Point: 10

Core Sequence: NLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQYKVLTRNIEYIAKCLKDHKATNSKGSEWKK

Homologies: Highest protein sequence identity to the following orthologs: Rat - 81%, Pig - 74%, Cynomolgus monkey - 93%

Alternative gene names: NACHRA9

Alternative protein names: Neuronal acetylcholine receptor subunit alpha-9; Nicotinic acetylcholine receptor subunit alpha-9; NACHR alpha-9

Protein name: cholinergic receptor nicotinic alpha 9 subunit

Full length: 479 amino acids

Entry name: ACHA9_HUMAN

• SKU: ASBPP-417-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-417-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55584