Recombinant Human CHST9 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q7L1S5

Gene Name: CHST9

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 48%

Start Site: Gly41

End Site: Ser180

Coverage: 0.33

Isoelectric Point: 11

Core Sequence: GRVEKRREQKVTSGWGPVKYLRPVPRIMSTEKIQEHITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQALSKSTGSPTEKLIEKRQGAKTVFNKFSNMNWPVDIHPLNKSLVKDNKWKKTEETQEKRRS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 48%, Pig - 67%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Carbohydrate sulfotransferase 9; GalNAc-4-O-sulfotransferase 2; GalNAc-4-ST2; GalNAc4ST-2; N-acetylgalactosamine-4-O-sulfotransferase 2

Protein name: carbohydrate sulfotransferase 9

Full length: 443 amino acids

Entry name: CHST9_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4305-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4305-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 83539