Recombinant Human CIART Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N365

Gene Name: CIART

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Thr21

End Site: Thr180

Coverage: 0.43

Isoelectric Point: 10

Core Sequence: TSPVNSDFGFPSDSEREDKGAHGPRPDTVGQRGGSRPSPGPIRCRHRSKVSGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Pig - 88%, Cynomolgus monkey - 98%

Alternative gene names: C1orf51

Alternative protein names: Circadian-associated transcriptional repressor; ChIP-derived repressor of network oscillator; Chrono; Computationally highlighted repressor of the network oscillator

Protein name: circadian associated repressor of transcription

Full length: 385 amino acids

Entry name: CIART_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10485-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10485-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 148523