Recombinant Human CKMT2 Protein

Recombinant Human CKMT2 Protein
SKU
ASBPP-4201-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P17540

Gene Name: CKMT2

Expression System: Escherichia coli

Molecular Weight: 44.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Glu40

End Site: Lys419

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: EVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 96%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Creatine kinase S-type; mitochondrial; Basic-type mitochondrial creatine kinase; Mib-CK; Sarcomeric mitochondrial creatine kinase; S-MtCK

Protein name: creatine kinase, mitochondrial 2

Full length: 419 amino acids

Entry name: KCRS_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4201-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4201-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1160
Product information (PDF)
×
MSDS (PDF)
×