Recombinant Human CLCN6 Protein

Recombinant Human CLCN6 Protein
SKU
ASBPP-3805-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P51797

Gene Name: CLCN6

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Gly581

End Site: Leu750

Coverage: 0.20

Isoelectric Point: 7

Core Sequence: GLRGVPLLEWETEVEMDKLRASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFKKSSILTRAGEQRKRSQSMKSYPSSELRNMCDEHIASEEPAEKEDLLQQMLERRYTPYPNLYPDQSPSEDWTMEERFRPLTFHGLILRSQL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 29%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0046

Alternative protein names: H(+)/Cl(-) exchange transporter 6; Chloride channel protein 6; ClC-6; Chloride transport protein 6

Protein name: chloride voltage-gated channel 6

Full length: 869 amino acids

Entry name: CLCN6_HUMAN
More Information
SKU ASBPP-3805-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3805-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1185
Product information (PDF)
×
MSDS (PDF)
×