Recombinant Human CNTN2 Protein

Recombinant Human CNTN2 Protein
SKU
ASBPP-373-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q02246

Gene Name: CNTN2

Expression System: Escherichia coli

Molecular Weight: 35 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Pro611

End Site: Glu810

Coverage: 0.20

Isoelectric Point: 6.5

Core Sequence: PGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGGGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTARVPGADAQYFVYSNESVRPYTPFEVKIRSYNRRGDGPESLTALVYSAEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 92%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: AXT; TAG1; TAX1

Alternative protein names: Contactin-2; Axonal glycoprotein TAG-1; Axonin-1; Transient axonal glycoprotein 1; TAX-1

Protein name: contactin 2

Full length: 1040 amino acids

Entry name: CNTN2_HUMAN
More Information
SKU ASBPP-373-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-373-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6900
Product information (PDF)
×
MSDS (PDF)
×