Recombinant Human COL6A5 Protein

Recombinant Human COL6A5 Protein
SKU
ASBPP-3774-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A8TX70

Gene Name: COL6A5

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 45%

Start Site: Glu2501

End Site: Asp2600

Coverage: 0.04

Isoelectric Point: 4

Core Sequence: EDMKATCVNMTSPNPENGGTENTVLLLPGIYEIKTENGDLFDEFDSQAQHLLVLGNNHSSGSETATDLMQKLYLLFSTEKLAMKDKEKAHLEEISALVVD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 45%, Pig - 58%

Alternative gene names: COL29A1; VWA4

Alternative protein names: Collagen alpha-5(VI) chain; Collagen alpha-1(XXIX) chain; von Willebrand factor A domain-containing protein 4

Protein name: collagen type VI alpha 5 chain

Full length: 2615 amino acids

Entry name: CO6A5_HUMAN
More Information
SKU ASBPP-3774-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3774-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 256076
Product information (PDF)
×
MSDS (PDF)
×