Recombinant Human COPS7B Protein

Recombinant Human COPS7B Protein
SKU
ASBPP-3992-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H9Q2

Gene Name: COPS7B

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Val171

End Site: Val260

Coverage: 0.39

Isoelectric Point: 8.5

Core Sequence: VKTLHEWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: CSN7B

Alternative protein names: COP9 signalosome complex subunit 7b; SGN7b; Signalosome subunit 7b; JAB1-containing signalosome subunit 7b

Protein name: COP9 signalosome subunit 7B

Full length: 264 amino acids

Entry name: CSN7B_HUMAN
More Information
SKU ASBPP-3992-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3992-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 64708
Product information (PDF)
×
MSDS (PDF)
×