Recombinant Human COPS8 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q99627

Gene Name: COPS8

Expression System: Escherichia coli

Molecular Weight: 62.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Phe11

End Site: Ile180

Coverage: 0.85

Isoelectric Point: 5.5

Core Sequence: FSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 95%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: CSN8

Alternative protein names: COP9 signalosome complex subunit 8; SGN8; Signalosome subunit 8; COP9 homolog; hCOP9; JAB1-containing signalosome subunit 8

Protein name: COP9 signalosome subunit 8

Full length: 209 amino acids

Entry name: CSN8_HUMAN

• SKU: ASBPP-3898-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3898-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 10920