Recombinant Human CSTF1 Protein

Recombinant Human CSTF1 Protein
SKU
ASBPP-3806-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q05048

Gene Name: CSTF1

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Asp61

End Site: Ala130

Coverage: 0.19

Isoelectric Point: 4.5

Core Sequence: DDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Cleavage stimulation factor subunit 1; CF-1 50 kDa subunit; Cleavage stimulation factor 50 kDa subunit; CSTF 50 kDa subunit; CstF-50

Protein name: cleavage stimulation factor subunit 1

Full length: 431 amino acids

Entry name: CSTF1_HUMAN
More Information
SKU ASBPP-3806-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3806-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 1477
Product information (PDF)
×
MSDS (PDF)
×