Recombinant Human CWH43 Protein

Recombinant Human CWH43 Protein
SKU
ASBPP-3816-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H720

Gene Name: CWH43

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Pro511

End Site: Glu680

Coverage: 0.25

Isoelectric Point: 7

Core Sequence: PIVKSEHHLLPSPEGEIAPAITLTVNISGKLVDFVVTHFGNHEDDLDRKLQAIAVSKLLKSSSNQVIFLGYITSAPGSRDYLQLTEHGNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Pig - 92%, Cynomolgus monkey - 97%

Alternative gene names: PGAP2IP

Alternative protein names: PGAP2-interacting protein; Cell wall biogenesis protein 43 C-terminal homolog

Protein name: cell wall biogenesis 43 C-terminal homolog

Full length: 699 amino acids

Entry name: PG2IP_HUMAN
More Information
SKU ASBPP-3816-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3816-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 80157
Product information (PDF)
×
MSDS (PDF)
×