Recombinant Human CYB5A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P00167

Gene Name: CYB5A

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Tyr11

End Site: Ile100

Coverage: 0.81

Isoelectric Point: 5.5

Core Sequence: YYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 87%, Pig - 91%, Cynomolgus monkey - 97%

Alternative gene names: CYB5

Alternative protein names: Cytochrome b5; Microsomal cytochrome b5 type A; MCB5

Protein name: cytochrome b5 type A

Full length: 134 amino acids

Entry name: CYB5_HUMAN

• SKU: ASBPP-3923-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3923-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1528