Recombinant Human CYB5A Protein

Recombinant Human CYB5A Protein
SKU
ASBPP-3923-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P00167

Gene Name: CYB5A

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Tyr11

End Site: Ile100

Coverage: 0.81

Isoelectric Point: 5.5

Core Sequence: YYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 87%, Pig - 91%, Cynomolgus monkey - 97%

Alternative gene names: CYB5

Alternative protein names: Cytochrome b5; Microsomal cytochrome b5 type A; MCB5

Protein name: cytochrome b5 type A

Full length: 134 amino acids

Entry name: CYB5_HUMAN
More Information
SKU ASBPP-3923-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3923-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 1528
Product information (PDF)
×
MSDS (PDF)
×