Recombinant Human Cytochrome P450 1A2 Protein

Recombinant Human Cytochrome P450 1A2 Protein
SKU
ASBPP-4155-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P05177

Gene Name: CYP1A2

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: His271

End Site: Ser360

Coverage: 0.18

Isoelectric Point: 10

Core Sequence: HYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 75%, Pig - 76%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Cytochrome P450 1A2; CYPIA2; Cholesterol 25-hydroxylase; Cytochrome P(3)450; Cytochrome P450 4; Cytochrome P450-P3; Hydroperoxy icosatetraenoate dehydratase

Protein name: cytochrome P450 family 1 subfamily A member 2

Full length: 516 amino acids

Entry name: CP1A2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4155-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4155-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1544
Product information (PDF)
×
MSDS (PDF)
×