Recombinant Human CYP3A7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P24462

Gene Name: CYP3A7

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Ser281

End Site: Gly480

Coverage: 0.42

Isoelectric Point: 7.5

Core Sequence: SKDSETHKALSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 76%, Pig - 73%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Cytochrome P450 3A7; CYPIIIA7; Cytochrome P450-HFLA; P450HLp2

Protein name: cytochrome P450 family 3 subfamily A member 7

Full length: 503 amino acids

Entry name: CP3A7_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4400-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4400-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1551