Recombinant Human CYP4F8 Protein

Recombinant Human CYP4F8 Protein
SKU
ASBPP-3832-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P98187

Gene Name: CYP4F8

Expression System: Escherichia coli

Molecular Weight: 57 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Phe41

End Site: Gly520

Coverage: 0.92

Isoelectric Point: 8

Core Sequence: FYHNGRRLRCFPQPRKQNWFLGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREPRRTPEIVLRAEDGLWLRVEPLG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 75%, Pig - 77%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Cytochrome P450 4F8; CYPIVF8

Protein name: cytochrome P450 family 4 subfamily F member 8

Full length: 520 amino acids

Entry name: CP4F8_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3832-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3832-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 11283
Product information (PDF)
×
MSDS (PDF)
×