Recombinant Human DBX2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZNG2

Gene Name: DBX2

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Leu201

End Site: Gly330

Coverage: 0.42

Isoelectric Point: 9

Core Sequence: LEKMFQKQKYISKTDRKKLAINLGLKESQVKIWFQNRRMKWRNSKEKEVLSNRCIQEVGLQEDPLSRSALGFPSPCPSIWDVPQQHSSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 77%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Homeobox protein DBX2; Developing brain homeobox protein 2

Protein name: developing brain homeobox 2

Full length: 339 amino acids

Entry name: DBX2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10486-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10486-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 440097