Recombinant Human DCAF13 Protein

Recombinant Human DCAF13 Protein
SKU
ASBPP-10463-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NV06

Gene Name: DCAF13

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Leu351

End Site: Asn420

Coverage: 0.18

Isoelectric Point: 11

Core Sequence: LWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: WDSOF1

Alternative protein names: DDB1- and CUL4-associated factor 13; WD repeat and SOF domain-containing protein 1

Protein name: DDB1 and CUL4 associated factor 13

Full length: 445 amino acids

Entry name: DCA13_HUMAN
More Information
SKU ASBPP-10463-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10463-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 25879
Product information (PDF)
×
MSDS (PDF)
×