Recombinant Human DDX18 Protein

Recombinant Human DDX18 Protein
SKU
ASBPP-10444-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NVP1

Gene Name: DDX18

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Arg21

End Site: Lys110

Coverage: 0.14

Isoelectric Point: 11

Core Sequence: RQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Pig - 63%, Cynomolgus monkey - 89%

Alternative gene names: cPERP-D

Alternative protein names: ATP-dependent RNA helicase DDX18; DEAD box protein 18; Myc-regulated DEAD box protein; MrDb

Protein name: DEAD-box helicase 18

Full length: 670 amino acids

Entry name: DDX18_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-10444-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10444-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 8886
Product information (PDF)
×
MSDS (PDF)
×