Recombinant Human DDX28 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NUL7

Gene Name: DDX28

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Leu131

End Site: Val350

Coverage: 0.42

Isoelectric Point: 6.5

Core Sequence: LGLEPRVLHALQEAAPEVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQLSRQPSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 31%, Pig - 87%

Alternative gene names: MDDX28

Alternative protein names: Probable ATP-dependent RNA helicase DDX28; Mitochondrial DEAD box protein 28

Protein name: DEAD-box helicase 28

Full length: 540 amino acids

Entry name: DDX28_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3743-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3743-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 55794