Recombinant Human DEFB103A Protein

Recombinant Human DEFB103A Protein
SKU
ASBPP-3729-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P81534

Gene Name: DEFB103B,DEFB103A

Expression System: Escherichia coli

Molecular Weight: 47.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Tyr31

End Site: Arg60

Coverage: 0.67

Isoelectric Point: 7.5

Core Sequence: YYCRVRGGRCAVLSCLPKEEQIGKCSTRGR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 68%

Alternative gene names: BD3; DEFB103; DEFB3

Alternative protein names: Beta-defensin 103; Beta-defensin 3; BD-3; DEFB-3; HBD3; hBD-3; Defensin; beta 103; Defensin-like protein

Protein name: defensin beta 103B,defensin beta 103A

Full length: 67 amino acids

Entry name: D103A_HUMAN
More Information
SKU ASBPP-3729-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3729-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 414325
Product information (PDF)
×
MSDS (PDF)
×