Recombinant Human DKC1 Protein

Recombinant Human DKC1 Protein
SKU
ASBPP-4329-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O60832

Gene Name: DKC1

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Leu391

End Site: Lys500

Coverage: 0.24

Isoelectric Point: 10

Core Sequence: LMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAKRKRESESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 58%, Pig - 69%, Cynomolgus monkey - 96%

Alternative gene names: NOLA4

Alternative protein names: H/ACA ribonucleoprotein complex subunit DKC1; CBF5 homolog; Dyskerin; Nopp140-associated protein of 57 kDa; Nucleolar protein NAP57; Nucleolar protein family A member 4; snoRNP protein DKC1

Protein name: dyskerin pseudouridine synthase 1

Full length: 514 amino acids

Entry name: DKC1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4329-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4329-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1736
Product information (PDF)
×
MSDS (PDF)
×