Recombinant Human DKK1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94907

Gene Name: DKK1

Expression System: Escherichia coli

Molecular Weight: 38 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Thr32

End Site: His266

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Dickkopf-related protein 1; Dickkopf-1; Dkk-1; hDkk-1; SK

Protein name: dickkopf WNT signaling pathway inhibitor 1

Full length: 266 amino acids

Entry name: DKK1_HUMAN

Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers

• SKU: ASBPP-039-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-039-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 22943