Recombinant Human DPY19L4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q7Z388

Gene Name: DPY19L4

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Thr551

End Site: Met670

Coverage: 0.17

Isoelectric Point: 6

Core Sequence: TELMELQEFYDPDTVELMTWIKRQAPVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKRSAEDIYKILTSYKANYLIVEDAICNEVGPMRGCRVKDLLDIANGHM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 33%

Alternative gene names: /

Alternative protein names: Probable C-mannosyltransferase DPY19L4; Dpy-19-like protein 4; Protein dpy-19 homolog 4

Protein name: dpy-19 like 4

Full length: 723 amino acids

Entry name: D19L4_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3728-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3728-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 286148