Recombinant Human Dopamine Receptor D1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P21728

Gene Name: DRD1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Phe341

End Site: Gln440

Coverage: 0.24

Isoelectric Point: 7

Core Sequence: FSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 90%, Pig - 93%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: D(1A) dopamine receptor; Dopamine D1 receptor

Protein name: dopamine receptor D1

Full length: 446 amino acids

Entry name: DRD1_HUMAN

• SKU: ASBPP-4394-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4394-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 1812