Recombinant Human DRD5 Protein

Recombinant Human DRD5 Protein
SKU
ASBPP-4395-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P21918

Gene Name: DRD5

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Arg381

End Site: Glu460

Coverage: 0.18

Isoelectric Point: 4.5

Core Sequence: RTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 76%, Pig - 65%, Cynomolgus monkey - 92%

Alternative gene names: DRD1B; DRD1L2

Alternative protein names: D(1B) dopamine receptor; D(5) dopamine receptor; D1beta dopamine receptor; Dopamine D5 receptor

Protein name: dopamine receptor D5

Full length: 477 amino acids

Entry name: DRD5_HUMAN
More Information
SKU ASBPP-4395-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4395-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 1816
Product information (PDF)
×
MSDS (PDF)
×