Recombinant Human Desmocollin 1 Protein

Recombinant Human Desmocollin 1 Protein
SKU
ASBPP-398-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q08554

Gene Name: DSC1

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Ser791

End Site: Glu870

Coverage: 0.12

Isoelectric Point: 5.5

Core Sequence: SNKGGGHQTLESVKGVGQGDTGRYAYTDWQSFTQPRLGEKVYLCGQDEEHKHCEDYVCSYNYEGKGSLAGSVGCCSDRQE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 36%, Pig - 90%, Cynomolgus monkey - 98%

Alternative gene names: CDHF1

Alternative protein names: Desmocollin-1; Cadherin family member 1; Desmosomal glycoprotein 2/3; DG2/DG3

Protein name: desmocollin 1

Full length: 894 amino acids

Entry name: DSC1_HUMAN
More Information
SKU ASBPP-398-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-398-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1823
Product information (PDF)
×
MSDS (PDF)
×