Recombinant Human DSC2 Protein

Recombinant Human DSC2 Protein
SKU
ASBPP-377-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q02487

Gene Name: DSC2

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Thr771

End Site: Lys890

Coverage: 0.16

Isoelectric Point: 6.5

Core Sequence: TVGSGIKNGGQETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKVYLCNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 33%, Pig - 84%, Cynomolgus monkey - 97%

Alternative gene names: CDHF2; DSC3

Alternative protein names: Desmocollin-2; Cadherin family member 2; Desmocollin-3; Desmosomal glycoprotein II; Desmosomal glycoprotein III

Protein name: desmocollin 2

Full length: 901 amino acids

Entry name: DSC2_HUMAN
More Information
SKU ASBPP-377-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-377-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1824
Product information (PDF)
×
MSDS (PDF)
×