Recombinant Human DUSP29 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q68J44

Gene Name: DUSP29

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Met1

End Site: Leu220

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 84%, Pig - 86%, Cynomolgus monkey - 96%

Alternative gene names: DUPD1; DUSP27

Alternative protein names: Dual specificity phosphatase 29; Dual specificity phosphatase 27; Dual specificity phosphatase DUPD1

Protein name: dual specificity phosphatase 29

Full length: 220 amino acids

Entry name: DUS29_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4264-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4264-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 338599