Recombinant Human DYSF Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O75923

Gene Name: DYSF

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Gln1441

End Site: Lys1550

Coverage: 0.05

Isoelectric Point: 4

Core Sequence: QGGPDDVSLLSPGEDVLIDIDDKEPLIPIQEEEFIDWWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Pig - 97%

Alternative gene names: FER1L1

Alternative protein names: Dysferlin; Dystrophy-associated fer-1-like protein; Fer-1-like protein 1

Protein name: dysferlin

Full length: 2080 amino acids

Entry name: DYSF_HUMAN

• SKU: ASBPP-3764-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3764-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 8291