Recombinant Human ECHDC1 Protein

Recombinant Human ECHDC1 Protein
SKU
ASBPP-409-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NTX5

Gene Name: ECHDC1

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Lys221

End Site: Trp290

Coverage: 0.26

Isoelectric Point: 5

Core Sequence: KNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 77%, Pig - 79%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Ethylmalonyl-CoA decarboxylase; Enoyl-CoA hydratase domain-containing protein 1; Methylmalonyl-CoA decarboxylase; MMCD

Protein name: ethylmalonyl-CoA decarboxylase 1

Full length: 307 amino acids

Entry name: ECHD1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-409-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-409-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 55862
Product information (PDF)
×
MSDS (PDF)
×