Recombinant Human EDF1 Protein

Recombinant Human EDF1 Protein
SKU
ASBPP-3917-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O60869

Gene Name: EDF1

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Lys148

Coverage: 1.00

Isoelectric Point: 10.5

Core Sequence: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Endothelial differentiation-related factor 1; EDF-1; Multiprotein-bridging factor 1; MBF1

Protein name: endothelial differentiation related factor 1

Full length: 148 amino acids

Entry name: EDF1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3917-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3917-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 8721
Product information (PDF)
×
MSDS (PDF)
×