Recombinant Human Endothelin Receptor B Protein

Recombinant Human Endothelin Receptor B Protein
SKU
ASBPP-3106-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P24530

Gene Name: EDNRB

Expression System: Escherichia coli

Molecular Weight: 9 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Phe31

End Site: Phe100

Coverage: 0.18

Isoelectric Point: 8.5

Core Sequence: FPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Rat - 68%, Pig - 68%, Cynomolgus monkey - 92%

Alternative gene names: ETRB

Alternative protein names: Endothelin receptor type B; ET-B; ET-BR; Endothelin receptor non-selective type

Protein name: endothelin receptor type B

Full length: 442 amino acids

Entry name: EDNRB_HUMAN
More Information
SKU ASBPP-3106-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3106-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1910
Product information (PDF)
×
MSDS (PDF)
×