Recombinant Human EFEMP2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95967

Gene Name: EFEMP2

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Glu31

End Site: Ser120

Coverage: 0.22

Isoelectric Point: 4.5

Core Sequence: EEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 52%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: FBLN4

Alternative protein names: EGF-containing fibulin-like extracellular matrix protein 2; Fibulin-4; FIBL-4; Protein UPH1

Protein name: EGF containing fibulin extracellular matrix protein 2

Full length: 443 amino acids

Entry name: FBLN4_HUMAN

• SKU: ASBPP-042-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-042-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 30008