Recombinant Human EFNA3 Protein

Recombinant Human EFNA3 Protein
SKU
ASBPP-3118-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P52797

Gene Name: EFNA3

Expression System: Escherichia coli

Molecular Weight: 34 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Gln23

End Site: Gly214

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 52%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: EFL2; EPLG3; LERK3

Alternative protein names: Ephrin-A3; EFL-2; EHK1 ligand; EHK1-L; EPH-related receptor tyrosine kinase ligand 3; LERK-3

Protein name: ephrin A3

Full length: 238 amino acids

Entry name: EFNA3_HUMAN
More Information
SKU ASBPP-3118-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3118-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 1944
Product information (PDF)
×
MSDS (PDF)
×