Recombinant Human ELL3 Protein

Recombinant Human ELL3 Protein
SKU
ASBPP-10450-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9HB65

Gene Name: ELL3

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: Ala121

End Site: Gln250

Coverage: 0.34

Isoelectric Point: 6.5

Core Sequence: APSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Rat - 65%, Pig - 72%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: RNA polymerase II elongation factor ELL3

Protein name: elongation factor for RNA polymerase II 3

Full length: 397 amino acids

Entry name: ELL3_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10450-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10450-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 80237
Product information (PDF)
×
MSDS (PDF)
×