Recombinant Human ELOC Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q15369

Gene Name: ELOC

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Cys112

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: TCEB1

Alternative protein names: Elongin-C; EloC; Elongin 15 kDa subunit; RNA polymerase II transcription factor SIII subunit C; SIII p15; Transcription elongation factor B polypeptide 1

Protein name: elongin C

Full length: 112 amino acids

Entry name: ELOC_HUMAN

• SKU: ASBPP-3852-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3852-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 6921