Recombinant Human ENTREP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q15884

Gene Name: ENTREP1

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Val201

End Site: Cys320

Coverage: 0.30

Isoelectric Point: 7

Core Sequence: VSQMDQEQGSSFQMSEGSEAAVIPLDLGCTQVTQDGDIPNIPAEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLHPSEERAAPVLSCEAATQTERRLDLAAVTLRRGLRSRASRC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Pig - 71%, Cynomolgus monkey - 91%

Alternative gene names: C9orf61; FAM189A2; X123

Alternative protein names: Endosomal transmembrane epsin interactor 1; Endosomal transmembrane binding with epsin

Protein name: endosomal transmembrane epsin interactor 1

Full length: 450 amino acids

Entry name: EREP1_HUMAN

• SKU: ASBPP-3174-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3174-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9413