Recombinant Human EPB42 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P16452

Gene Name: EPB42

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Asp401

End Site: Gly520

Coverage: 0.17

Isoelectric Point: 6

Core Sequence: DGTLELTDSNTKYVGNNISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPPSLETASPLYLLLKAPSSLPLRGDAQISVTLVNHSEQEKAVQLAIGVQAVHYNG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Rat - 31%, Pig - 69%, Cynomolgus monkey - 93%

Alternative gene names: E42P

Alternative protein names: Protein 4.2; P4.2; Erythrocyte membrane protein band 4.2; Erythrocyte protein 4.2

Protein name: erythrocyte membrane protein band 4.2

Full length: 691 amino acids

Entry name: EPB42_HUMAN

• SKU: ASBPP-4166-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4166-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 2038