Recombinant Human ERGIC3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y282

Gene Name: ERGIC3

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Val91

End Site: Gln200

Coverage: 0.29

Isoelectric Point: 4.5

Core Sequence: VAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: C20orf47; ERV46; SDBCAG84

Alternative protein names: Endoplasmic reticulum-Golgi intermediate compartment protein 3; Serologically defined breast cancer antigen NY-BR-84

Protein name: ERGIC and golgi 3

Full length: 383 amino acids

Entry name: ERGI3_HUMAN

• SKU: ASBPP-3799-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3799-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 51614