Recombinant Human ERP27 Protein

Recombinant Human ERP27 Protein
SKU
ASBPP-4231-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96DN0

Gene Name: ERP27

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Ser31

End Site: Glu260

Coverage: 0.98

Isoelectric Point: 4.5

Core Sequence: SDGPGAAQEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIPAVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Rat - 33%, Pig - 76%, Cynomolgus monkey - 95%

Alternative gene names: C12orf46

Alternative protein names: Endoplasmic reticulum resident protein 27; ER protein 27; ERp27; Inactive protein disulfide-isomerase 27

Protein name: endoplasmic reticulum protein 27

Full length: 273 amino acids

Entry name: ERP27_HUMAN
More Information
SKU ASBPP-4231-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4231-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 121506
Product information (PDF)
×
MSDS (PDF)
×