Recombinant Human ERP29 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P30040

Gene Name: ERP29

Expression System: Escherichia coli

Molecular Weight: 27 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Leu33

End Site: Leu261

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: LHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 92%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: C12orf8; ERP28

Alternative protein names: Endoplasmic reticulum resident protein 29; ERp29; Endoplasmic reticulum resident protein 28; ERp28; Endoplasmic reticulum resident protein 31; ERp31

Protein name: endoplasmic reticulum protein 29

Full length: 261 amino acids

Entry name: ERP29_HUMAN

• SKU: ASBPP-4409-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4409-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 10961