Recombinant Human ERVK-10 Protein

Recombinant Human ERVK-10 Protein
SKU
ASBPP-3171-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P87889

Gene Name: ERVK-10

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ala91

End Site: Lys200

Coverage: 0.17

Isoelectric Point: 4.5

Core Sequence: ALEPFQTEEDSISVSDAPGSCLIDCNENTRKKSQKETESLHCEYVAEPVMAQSTQNVDYNQLQEVIYPETLKLEGKGPELMGPSESKPRGTSPLPAGQVLVRLQPQKQVK

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 65%

Alternative gene names: /

Alternative protein names: Endogenous retrovirus group K member 10 Gag polyprotein; HERV-K10 Gag protein; HERV-K107 Gag protein; HERV-K_5q33.3 provirus ancestral Gag polyprotein; Gag polyprotein

Protein name: Endogenous retrovirus group K member 10 Gag polyprotein (HERV-K10 Gag protein) (HERV-K107 Gag protein) (HERV-K_5q33.3 provirus ancestral Gag polyprotein) (Gag polyprotein)

Full length: 666 amino acids

Entry name: GAK10_HUMAN
More Information
SKU ASBPP-3171-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3171-100
Package Unit 100 μg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×