Recombinant Human F13A1 Protein

Recombinant Human F13A1 Protein
SKU
ASBPP-046-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P00488

Gene Name: F13A1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Phe431

End Site: Asp520

Coverage: 0.14

Isoelectric Point: 5

Core Sequence: FVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSNVD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 88%, Pig - 86%, Cynomolgus monkey - 99%

Alternative gene names: F13A

Alternative protein names: Coagulation factor XIII A chain; Coagulation factor XIIIa; Protein-glutamine gamma-glutamyltransferase A chain; Transglutaminase A chain

Protein name: coagulation factor XIII A chain

Full length: 732 amino acids

Entry name: F13A_HUMAN

Product panel: IHC Pathology,Enzyme
More Information
SKU ASBPP-046-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-046-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2162
Product information (PDF)
×
MSDS (PDF)
×