Note: Dry Ice fees will be extra-charged
Uniprot: P00488
Gene Name: F13A1
Expression System: Escherichia coli
Molecular Weight: 13 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 90%
Start Site: Phe431
End Site: Asp520
Coverage: 0.14
Isoelectric Point: 5
Core Sequence: FVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSNVD
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 88%, Pig - 86%, Cynomolgus monkey - 99%
Alternative gene names: F13A
Alternative protein names: Coagulation factor XIII A chain; Coagulation factor XIIIa; Protein-glutamine gamma-glutamyltransferase A chain; Transglutaminase A chain
Protein name: coagulation factor XIII A chain
Full length: 732 amino acids
Entry name: F13A_HUMAN
Product panel: IHC Pathology,Enzyme
English
Deutsch
