Recombinant Human FAM162A Protein

Recombinant Human FAM162A Protein
SKU
ASBPP-3977-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96A26

Gene Name: FAM162A

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Asp21

End Site: Arg100

Coverage: 0.54

Isoelectric Point: 10.5

Core Sequence: DVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 80%

Alternative gene names: C3orf28; E2IG5

Alternative protein names: Protein FAM162A; E2-induced gene 5 protein; Growth and transformation-dependent protein; HGTD-P

Protein name: family with sequence similarity 162 member A

Full length: 154 amino acids

Entry name: F162A_HUMAN
More Information
SKU ASBPP-3977-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3977-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 26355
Product information (PDF)
×
MSDS (PDF)
×