Recombinant Human FDPS Protein

Recombinant Human FDPS Protein
SKU
ASBPP-4385-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P14324

Gene Name: FDPS

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: His291

End Site: Phe380

Coverage: 0.25

Isoelectric Point: 4.5

Core Sequence: HANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 88%, Pig - 92%, Cynomolgus monkey - 96%

Alternative gene names: FPS; KIAA1293

Alternative protein names: Farnesyl pyrophosphate synthase; FPP synthase; FPS; (2E; 6E)-farnesyl diphosphate synthase; Dimethylallyltranstransferase; Farnesyl diphosphate synthase; Geranyltranstransferase

Protein name: farnesyl diphosphate synthase

Full length: 419 amino acids

Entry name: FPPS_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4385-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4385-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 2224
Product information (PDF)
×
MSDS (PDF)
×