Recombinant Human FGF13 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q92913

Gene Name: FGF13

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Leu171

End Site: Ser240

Coverage: 0.34

Isoelectric Point: 10.5

Core Sequence: LGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: FHF2

Alternative protein names: Fibroblast growth factor 13; FGF-13; Fibroblast growth factor homologous factor 2; FHF-2

Protein name: fibroblast growth factor 13

Full length: 245 amino acids

Entry name: FGF13_HUMAN

• SKU: ASBPP-10497-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10497-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 2258